REPIN1 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18451
- Bilder (1)
| Artikelname: | REPIN1 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18451 |
| Hersteller Artikelnummer: | A18451 |
| Alternativnummer: | ABB-A18451-100UL,ABB-A18451-20UL,ABB-A18451-1000UL,ABB-A18451-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | AP4, RIP60, ZNF464, Zfp464, REPIN1 |
| Enables RNA binding activity. Predicted to be involved in regulation of transcription by RNA polymerase II. Predicted to act upstream of or within positive regulation of glucose import and regulation of fatty acid transport. Located in nucleoplasm. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 64kDa |
| NCBI: | 29803 |
| UniProt: | Q9BWE0 |
| Reinheit: | Affinity purification |
| Sequenz: | SCDDCGRSFRLERFLRAHQRQHTGERPFTCAECGKNFGKKTHLVAHSRVHSGERPFACEECGRRFSQGSHLAAHRRDHAPDRPFVCPDCGKAFRHKPYLAAHRRIHTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCDRSFSQKSNLITHRKSHIRDGAFCCAICGQTFDDEERLLAHQKKHDV |
| Target-Kategorie: | REPIN1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,RNA Binding. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using REPIN1 Rabbit pAb (A18451) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
