PANK2 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18502
Artikelname: PANK2 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18502
Hersteller Artikelnummer: A18502
Alternativnummer: ABB-A18502-20UL,ABB-A18502-100UL,ABB-A18502-500UL,ABB-A18502-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: HSS, HARP, PKAN, NBIA1, C20orf48, PANK2
This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 63kDa
NCBI: 80025
UniProt: Q9BZ23
Reinheit: Affinity purification
Sequenz: RDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYIDSVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVY
Target-Kategorie: PANK2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Endocrine Metabolism,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung, using PANK2 Rabbit pAb (A18502) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.