ZNF645 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18553
Artikelname: ZNF645 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18553
Hersteller Artikelnummer: A18553
Alternativnummer: ABB-A18553-20UL,ABB-A18553-100UL,ABB-A18553-1000UL,ABB-A18553-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: CT138, HAKAIL, ZNF645
This gene encodes a member of the zinc finger domain-containing protein family. This family member contains both a RING-type and a C2H2-type of zinc finger domain, and it may function as an E3 ubiquitin-protein ligase. Protein localization suggests a role in human sperm production and quality control.
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 158506
UniProt: Q8N7E2
Reinheit: Affinity purification
Sequenz: QNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY
Target-Kategorie: CBLL2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using ZNF645 Rabbit pAb (A18553) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.