MCOLN2 Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18560
- Bilder (1)
| Artikelname: | MCOLN2 Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18560 |
| Hersteller Artikelnummer: | A18560 |
| Alternativnummer: | ABB-A18560-20UL,ABB-A18560-100UL,ABB-A18560-500UL,ABB-A18560-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | TRPML2, TRP-ML2, MCOLN2 |
| Mucolipins constitute a family of cation channel proteins with homology to the transient receptor potential superfamily. In mammals, the mucolipin family includes 3 members, MCOLN1 (MIM 605248), MCOLN2, and MCOLN3 (MIM 607400), that exhibit a common 6-membrane-spanning topology. Homologs of mammalian mucolipins exist in Drosophila and C. elegans. Mutations in the human MCOLN1 gene cause mucolipodosis IV (MIM 262650) (Karacsonyi et al., 2007 [PubMed 17662026]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 66kDa |
| NCBI: | 255231 |
| UniProt: | Q8IZK6 |
| Reinheit: | Affinity purification |
| Sequenz: | VVAFKEDNTVAFKHLFLKGYSGTDEDDYSCSVYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLDLQDLSKKPPDWKNSSFFRLEFYRLLQVEISFHLKGIDLQTIHSRELPDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECK |
| Target-Kategorie: | MCOLN2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using MCOLN2 Rabbit pAb (A18560) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
