PPP2R1A/PPP2R2A/PPP2R1B Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18571
- Bilder (1)
| Artikelname: | PPP2R1A/PPP2R2A/PPP2R1B Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18571 |
| Hersteller Artikelnummer: | A18571 |
| Alternativnummer: | ABB-A18571-20UL,ABB-A18571-100UL,ABB-A18571-1000UL,ABB-A18571-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | PPP2R1A/PPP2R2A/PPP2R1B |
| Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit.The B regulatory subunit might modulate substrate selectivity and catalytic activity. |
| Klonalität: | Polyclonal |
| NCBI: | 5518 |
| UniProt: | P30153 |
| Reinheit: | Affinity purification |
| Sequenz: | MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSA |
| Target-Kategorie: | PPP2R1A/PPP2R2A/PPP2R1B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PPP2R1A/PPP2R2A/PPP2R1B Rabbit pAb (A18571) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
