CENPF Rabbit pAb, Polyclonal
Artikelnummer:
ABB-A18644
- Bilder (1)
| Artikelname: | CENPF Rabbit pAb, Polyclonal |
| Artikelnummer: | ABB-A18644 |
| Hersteller Artikelnummer: | A18644 |
| Alternativnummer: | ABB-A18644-100UL,ABB-A18644-20UL,ABB-A18644-500UL,ABB-A18644-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Alternative Synonym: | CENF, hcp-1, CILD31, STROMS, PRO1779, CENPF |
| This gene encodes a protein that associates with the centromere-kinetochore complex. The protein is a component of the nuclear matrix during the G2 phase of interphase. In late G2 the protein associates with the kinetochore and maintains this association through early anaphase. It localizes to the spindle midzone and the intracellular bridge in late anaphase and telophase, respectively, and is thought to be subsequently degraded. The localization of this protein suggests that it may play a role in chromosome segregation during mitotis. It is thought to form either a homodimer or heterodimer. Autoantibodies against this protein have been found in patients with cancer or graft versus host disease. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 358kDa |
| NCBI: | 1063 |
| UniProt: | P49454 |
| Reinheit: | Affinity purification |
| Sequenz: | NYEPPGEDKTQGSSECISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQELLQRVETSEGLNSDLEMHADKSSREDIGDNVAKVN |
| Target-Kategorie: | CENPF |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from HeLa cells, using CENPF Rabbit pAb (A18644) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
