KLF11 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18659
Artikelname: KLF11 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18659
Hersteller Artikelnummer: A18659
Alternativnummer: ABB-A18659-20UL,ABB-A18659-100UL,ABB-A18659-1000UL,ABB-A18659-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: FKLF, FKLF1, MODY7, TIEG2, Tieg3, KLF11
The protein encoded by this gene is a zinc finger transcription factor that binds to SP1-like sequences in epsilon- and gamma-globin gene promoters. This binding inhibits cell growth and causes apoptosis. Defects in this gene are a cause of maturity-onset diabetes of the young type 7 (MODY7). Three transcript variants encoding two different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 8462
UniProt: O14901
Reinheit: Affinity purification
Sequenz: RAVDIMDICESILERKRHDSERSTCSILEQTDMEAVEALVCMSSWGQRSQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCIT
Target-Kategorie: KLF11
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using KLF11 Rabbit pAb (A18659) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.