FTO Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A18672
- Bilder (1)
| Artikelname: | FTO Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A18672 |
| Hersteller Artikelnummer: | A18672 |
| Alternativnummer: | ABB-A18672-20UL,ABB-A18672-100UL,ABB-A18672-1000UL,ABB-A18672-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Predicted to enable 2-oxoglutarate-dependent dioxygenase activity and ferrous iron binding activity. Acts upstream of or within several processes, including cilium assembly, left/right pattern formation, and positive regulation of canonical Wnt signaling pathway. Predicted to be located in cytoplasm and nuclear speck. Human ortholog(s) of this gene implicated in obesity. Orthologous to human FTO (FTO alpha-ketoglutarate dependent dioxygenase). |
| Klonalität: | Polyclonal |
| NCBI: | 553363 |
| Reinheit: | Affinity purification |
| Sequenz: | MKPRQRKQYFRNMKRSDDSEREKRRKRRRLLQELGEQRIPYLSPTDPGFQDLWDSSYAGLALRQSGTLPEGLHEKVQSALLTLQRHGCLLRDLVRVRDRDVFTAVSRALVGQPGYTYRYLDTRLFTIPWHCEGEEGQKDEKGKPCCDSDLRDACKALWELNQFFCSDVKQQTNARGVKRTRSDTENSEDAPGEGMCEEESVKDRLVEEKTIEEEEEDSGQGCSHSSPPSSTPPAAQASLVQFNVTLINYMNPAAM |
| Target-Kategorie: | fto |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience Neurology process MetabolismCardiovascular Atherosclerosis Lipoprotein metabolismCardiovascular Atherosclerosis Lipid transportCardiovascular Atherosclerosis Diabetes associatedMetabolism Pathways and Processes Metabolic signaling pathways Lipid and lipoprotein metabolism Lipoprotein metabolismMetabolism Types of disease DiabetesMetabolism Types of disease ObesityMetabolism Types of disease CancerMetabolism Types of disease Heart diseaseMetabolism Types of disease Metabolic disorders. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using FTO Rabbit pAb (A18672) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
