SPAG11A Rabbit pAb, Polyclonal

Artikelnummer: ABB-A18673
Artikelname: SPAG11A Rabbit pAb, Polyclonal
Artikelnummer: ABB-A18673
Hersteller Artikelnummer: A18673
Alternativnummer: ABB-A18673-20UL,ABB-A18673-100UL,ABB-A18673-1000UL,ABB-A18673-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Synonym: HE2, EDDM2A, SPAG11A
Involved in antimicrobial humoral immune response mediated by antimicrobial peptide and cytolysis by host of symbiont cells. Predicted to be located in extracellular region.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 653423
UniProt: Q6PDA7
Reinheit: Affinity purification
Sequenz: MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNG
Target-Kategorie: SPAG11A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from Rat testis, using SPAG11A Rabbit pAb (A18673) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.