SLPI Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1897
Artikelname: SLPI Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1897
Hersteller Artikelnummer: A1897
Alternativnummer: ABB-A1897-20UL,ABB-A1897-100UL,ABB-A1897-1000UL,ABB-A1897-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ALP, MPI, ALK1, BLPI, HUSI, WAP4, WFDC4, HUSI-I, SLPI
This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 6590
UniProt: P03973
Reinheit: Affinity purification
Sequenz: SGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Target-Kategorie: SLPI
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular. Shipping: Ice Bag
Western blot analysis of various lysates using SLPI Rabbit pAb (A1897) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.