LMO2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1903
- Bilder (1)
| Artikelname: | LMO2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1903 |
| Hersteller Artikelnummer: | A1903 |
| Alternativnummer: | ABB-A1903-100UL,ABB-A1903-20UL,ABB-A1903-1000UL,ABB-A1903-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TTG2, LMO-2, RBTN2, RHOM2, RBTNL1, LMO2 |
| LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 18kDa |
| NCBI: | 4005 |
| UniProt: | P25791 |
| Reinheit: | Affinity purification |
| Sequenz: | MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI |
| Target-Kategorie: | LMO2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cardiovascular,Blood. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using LMO2 Rabbit pAb (A1903) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
