HOXA9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1908
- Bilder (1)
| Artikelname: | HOXA9 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1908 |
| Hersteller Artikelnummer: | A1908 |
| Alternativnummer: | ABB-A1908-100UL,ABB-A1908-20UL,ABB-A1908-500UL,ABB-A1908-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HOX1, ABD-B, HOX1G, HOX1.7, HOXA9 |
| In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is highly similar to the abdominal-B (Abd-B) gene of Drosophila. A specific translocation event which causes a fusion between this gene and the NUP98 gene has been associated with myeloid leukemogenesis. Read-through transcription exists between this gene and the upstream homeobox A10 (HOXA10) gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 30kDa |
| NCBI: | 3205 |
| UniProt: | P31269 |
| Reinheit: | Affinity purification |
| Sequenz: | MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPP |
| Target-Kategorie: | HOXA9 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using HOXA9 Rabbit pAb (A1908) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
