MAN2A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A19323
Artikelname: MAN2A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A19323
Hersteller Artikelnummer: A19323
Alternativnummer: ABB-A19323-100UL,ABB-A19323-20UL,ABB-A19323-1000UL,ABB-A19323-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MANA2X, MAN2A2
Predicted to enable alpha-mannosidase activity. Predicted to be involved in N-glycan processing and protein deglycosylation. Predicted to be integral component of membrane. Predicted to be active in Golgi membrane.
Klonalität: Polyclonal
Molekulargewicht: 131kDa
NCBI: 4122
UniProt: P49641
Reinheit: Affinity purification
Sequenz: VPPEPRPSFFSISPQDCQFALGGRGQKPELQMLTVSEELPFDNVDGGVWRQGFDISYDPHDWDAEDLQVFVVPHSHNDPGWIKTFDKYYTEQTQHILNSMV
Target-Kategorie: MAN2A2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of lysates from U-87MG cells, using MAN2A2 Rabbit pAb (A19323) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.