SMARCC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1967
Artikelname: SMARCC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1967
Hersteller Artikelnummer: A1967
Alternativnummer: ABB-A1967-100UL,ABB-A1967-20UL,ABB-A1967-500UL,ABB-A1967-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CSS8, Rsc8, BAF170, CRACC2, SMARCC2
The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and contains a predicted leucine zipper motif typical of many transcription factors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 133kDa
NCBI: 6601
UniProt: Q8TAQ2
Reinheit: Affinity purification
Sequenz: PKLLGKLKDIIKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNE
Target-Kategorie: SMARCC2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling. Shipping: Ice Bag
Western blot analysis of various lysates, using SMARCC2 Rabbit pAb (A1967) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.