HSD17B2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A1983
Artikelname: HSD17B2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A1983
Hersteller Artikelnummer: A1983
Alternativnummer: ABB-A1983-100UL,ABB-A1983-20UL,ABB-A1983-500UL,ABB-A1983-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HSD17, SDR9C2, EDH17B2, HSD17B2
Enables estradiol 17-beta-dehydrogenase activity and testosterone dehydrogenase (NAD+) activity. Involved in response to retinoic acid. Predicted to be located in endoplasmic reticulum membrane.
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 3294
UniProt: P37059
Reinheit: Affinity purification
Sequenz: KYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVT
Target-Kategorie: HSD17B2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates, using HSD17B2 Rabbit pAb (A1983) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.1s.