CD244 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1993
- Bilder (1)
| Artikelname: | CD244 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1993 |
| Hersteller Artikelnummer: | A1993 |
| Alternativnummer: | ABB-A1993-100UL,ABB-A1993-20UL,ABB-A1993-500UL,ABB-A1993-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 2B4, NAIL, Nmrk, NKR2B4, SLAMF4, CD244 |
| This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 42kDa |
| NCBI: | 51744 |
| UniProt: | Q9BZW8 |
| Reinheit: | Affinity purification |
| Sequenz: | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWP |
| Target-Kategorie: | CD244 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using CD244 Rabbit pAb (A1993) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
