SMARCA5/SNF2H Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2000
- Bilder (1)
| Artikelname: | SMARCA5/SNF2H Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2000 |
| Hersteller Artikelnummer: | A2000 |
| Alternativnummer: | ABB-A2000-100UL,ABB-A2000-20UL,ABB-A2000-1000UL,ABB-A2000-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ISWI, SNF2H, hISWI, hSNF2H, WCRF135, SMARCA5/SNF2H |
| The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 122kDa |
| NCBI: | 8467 |
| UniProt: | O60264 |
| Reinheit: | Affinity purification |
| Sequenz: | ELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFL |
| Target-Kategorie: | SMARCA5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SMARCA5/SNF2H Rabbit pAb (A2000) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 2min. |
Produktgarantie und fachkundiger Support
