BAT3/BAG6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2010
- Bilder (1)
| Artikelname: | BAT3/BAG6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2010 |
| Hersteller Artikelnummer: | A2010 |
| Alternativnummer: | ABB-A2010-20UL,ABB-A2010-100UL,ABB-A2010-1000UL,ABB-A2010-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | G3, BAT3, BAG-6, D6S52E, BAT3/BAG6 |
| This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 119kDa |
| NCBI: | 7917 |
| UniProt: | P46379 |
| Reinheit: | Affinity purification |
| Sequenz: | MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMECRGGPQPQHSQPPPQP |
| Target-Kategorie: | BAG6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using BAT3/BAG6 Rabbit pAb (A2010) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
