HOXB2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20158
Artikelname: HOXB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20158
Hersteller Artikelnummer: A20158
Alternativnummer: ABB-A20158-100UL,ABB-A20158-20UL,ABB-A20158-500UL,ABB-A20158-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: K8, HOX2, HOX2H, Hox-2.8, HOXB2
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Increased expression of this gene is associated with pancreatic cancer.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 3212
UniProt: P14652
Reinheit: Affinity purification
Sequenz: EQTFPSLQPGASTLQRPRSQKRAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGG
Target-Kategorie: HOXB2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor biomarkers. Shipping: Ice Bag
Western blot analysis of lysates from Mouse kidney, using HOXB2 Rabbit pAb (A20158) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.