HJURP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20169
- Bilder (1)
| Artikelname: | HJURP Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20169 |
| Hersteller Artikelnummer: | A20169 |
| Alternativnummer: | ABB-A20169-100UL,ABB-A20169-20UL,ABB-A20169-1000UL,ABB-A20169-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FAKTS, URLC9, hFLEG1, HJURP |
| Enables histone binding activity and identical protein binding activity. Involved in several processes, including CENP-A containing chromatin assembly, regulation of DNA binding activity, and regulation of protein-containing complex assembly. Located in kinetochore, mitochondrion, and nuclear lumen. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 84kDa |
| NCBI: | 55355 |
| UniProt: | Q8NCD3 |
| Reinheit: | Affinity purification |
| Sequenz: | MLGTLRAMEGEDVEDDQLLQKLRASRRRFQRRMQRLIEKYNQPFEDTPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQAAAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNELRRKYLTQVDILLQGAEYFECAGNRAGRDVRVTPLPSLASPAVPA |
| Target-Kategorie: | HJURP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using HJURP Rabbit pAb (A20169) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
