GIMAP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20356
- Bilder (1)
| Artikelname: | GIMAP1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20356 |
| Hersteller Artikelnummer: | A20356 |
| Alternativnummer: | ABB-A20356-20UL,ABB-A20356-100UL,ABB-A20356-500UL,ABB-A20356-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IAN2, IMAP1, HIMAP1, IMAP38, GIMAP1 |
| This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene is thought to be involved in the differentiation of T helper (Th) cells of the Th1 lineage, and the related mouse gene has been shown to be critical for the development of mature B and T lymphocytes. Read-through transcription exists between this gene and the downstream GIMAP5 (GTPase, IMAP family member 5) gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 34kDa |
| NCBI: | 170575 |
| UniProt: | Q8WWP7 |
| Reinheit: | Affinity purification |
| Sequenz: | GEDVLKWMVIVFTRKEDLAGGSLHDYVSNTENRALRELVAECGGRVCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQRRPWGAWLSARLWKWLKSPRSWRLGLAL |
| Target-Kategorie: | GIMAP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat lung usingGIMAP1 Rabbit pAb (A20356) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 15s. |
Produktgarantie und fachkundiger Support
