CD69 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A2045
Artikelname: CD69 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A2045
Hersteller Artikelnummer: A2045
Alternativnummer: ABB-A2045-100UL,ABB-A2045-20UL,ABB-A2045-1000UL,ABB-A2045-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AIM, EA1, MLR-3, CLEC2C, GP32/28, BL-AC/P26, CD69
This gene encodes a member of the calcium dependent lectin superfamily of type II transmembrane receptors. Expression of the encoded protein is induced upon activation of T lymphocytes, and may play a role in proliferation. Furthermore, the protein may act to transmit signals in natural killer cells and platelets.
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 969
UniProt: Q07108
Reinheit: Affinity purification
Sequenz: MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQVPVLCAVMNVVFITILIIALIALSVGQYNCPGQYTFSMPSDS
Target-Kategorie: CD69
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag
Western blot analysis of various lysates using CD69 Rabbit pAb (A2045) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.