HOXB6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20451
Artikelname: HOXB6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20451
Hersteller Artikelnummer: A20451
Alternativnummer: ABB-A20451-100UL,ABB-A20451-20UL,ABB-A20451-1000UL,ABB-A20451-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HOX2, HU-2, HOX2B, Hox-2.2, HOXB6
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 3216
UniProt: P17509
Reinheit: Affinity purification
Sequenz: SGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQ
Target-Kategorie: HOXB6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using HOXB6 Rabbit pAb (A20451) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 240s.