SLFN11 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20490
- Bilder (1)
| Artikelname: | SLFN11 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20490 |
| Hersteller Artikelnummer: | A20490 |
| Alternativnummer: | ABB-A20490-20UL,ABB-A20490-100UL,ABB-A20490-1000UL,ABB-A20490-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SLFN8/9, SLFN11 |
| Enables tRNA binding activity. Involved in several processes, including defense response to virus, negative regulation of G1/S transition of mitotic cell cycle, and replication fork arrest. Located in cytosol, nucleoplasm, and site of DNA damage. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 103kDa |
| NCBI: | 91607 |
| UniProt: | Q7Z7L1 |
| Reinheit: | Affinity purification |
| Sequenz: | LYRRSETSVRSMDSREAFCFLKTKRKPKILEEGPFHKIHKGVYQELPNSDPADPNSDPADLIFQKDYLEYGEILPFPESQLVEFKQFSTKHFQEYVKRTIPEYVPAFANTGGGYLFIGVDDKSREVLGCAKENVDPDSLRRKIEQAIYKLPCVHFCQPQRPITFTLKIVNVLKRGELYGYACMIRVNPFCCAVFSEA |
| Target-Kategorie: | SLFN11 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SLFN11 Rabbit pAb (A20490) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
