TRUB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20492
- Bilder (1)
| Artikelname: | TRUB1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20492 |
| Hersteller Artikelnummer: | A20492 |
| Alternativnummer: | ABB-A20492-20UL,ABB-A20492-100UL,ABB-A20492-1000UL,ABB-A20492-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PUS4, TRUB1 |
| Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 37kDa |
| NCBI: | 142940 |
| UniProt: | Q8WWH5 |
| Reinheit: | Affinity purification |
| Sequenz: | PSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGKATDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRLSTLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGGFYIRSLVSDIGKELSSCANVLELTRTKQ |
| Target-Kategorie: | TRUB1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using TRUB1 Rabbit pAb (A20492) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
