ABCA8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20553
Artikelname: ABCA8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20553
Hersteller Artikelnummer: A20553
Alternativnummer: ABB-A20553-20UL,ABB-A20553-100UL,ABB-A20553-500UL,ABB-A20553-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ABCA8
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. The encoded protein may regulate lipid metabolism and be involved in the formation and maintenance of myelin. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 184kDa
NCBI: 10351
UniProt: O94911
Reinheit: Affinity purification
Sequenz: NEYGHRRPPLFFLKSSFWSQTQKTDHVALEDEMDADPSFHDSFEQAPPEFQGKEAIRIRNVTKEYKGKPDK
Target-Kategorie: ABCA8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Drug metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using ABCA8 Rabbit pAb (A20553) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.