TOM1L2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A20563
- Bilder (1)
| Artikelname: | TOM1L2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A20563 |
| Hersteller Artikelnummer: | A20563 |
| Alternativnummer: | ABB-A20563-20UL,ABB-A20563-100UL,ABB-A20563-500UL,ABB-A20563-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TOM1L2 |
| This gene belongs to a small gene family whose members have an N-terminal VHS domain followed by a GAT domain, domains which typically participate in vesicular trafficking. The canonical protein encoded by this gene also has a C-terminal clathrin binding motif. This protein has been shown to interact with Tollip, clathrin and ubiquitin and is thought to play a role in endosomal sorting. This gene resides in the 3.7 Mb deletion of chromosome region 17p11.2 that is associated with Smith-Magenis syndrome. Alternative splicing results in multiple transcript variants encoding distinct proteins. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 56kDa |
| NCBI: | 146691 |
| UniProt: | Q6ZVM7 |
| Reinheit: | Affinity purification |
| Sequenz: | SGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDD |
| Target-Kategorie: | TOM1L2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction Protein Trafficking Golgi Proteins. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using TOM1L2 Rabbit pAb (A20563) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
