MEIS3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20567
Artikelname: MEIS3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20567
Hersteller Artikelnummer: A20567
Alternativnummer: ABB-A20567-20UL,ABB-A20567-100UL,ABB-A20567-1000UL,ABB-A20567-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MRG2, MEIS3
This gene encodes a homeobox protein and probable transcriptional regulator. The orthologous protein in mouse controls expression of 3-phosphoinositide dependent protein kinase 1, which promotes survival of pancreatic beta-cells.
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 56917
UniProt: Q99687
Reinheit: Affinity purification
Sequenz: IDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL
Target-Kategorie: MEIS3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using MEIS3 Rabbit pAb (A20567) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.