CDKN1C/p57 Kip2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A2060
Artikelname: CDKN1C/p57 Kip2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A2060
Hersteller Artikelnummer: A2060
Alternativnummer: ABB-A2060-100UL,ABB-A2060-20UL,ABB-A2060-1000UL,ABB-A2060-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BWS, WBS, p57, BWCR, KIP2, p57Kip2, CDKN1C/p57 Kip2
This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 1028
UniProt: P49918
Reinheit: Affinity purification
Sequenz: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPR
Target-Kategorie: CDKN1C
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Kinase,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors. Shipping: Ice Bag
Western blot analysis of various lysates using CDKN1C/p57 Kip2 Rabbit pAb (A2060) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.