EV71 3C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A20687
Artikelname: EV71 3C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A20687
Hersteller Artikelnummer: A20687
Alternativnummer: ABB-A20687-20UL,ABB-A20687-100UL,ABB-A20687-1000UL,ABB-A20687-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Virus
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Enterovirus 71 (EV71) is the main pathogen of the hand, foot, and mouth disease. It was firstly isolated from sputum specimens of infants with central nervous system diseases in California in 1969, and has been repeatedly reported in various parts of the world, especially in the Asia-Pacific region. Infection with EV71 can lead tosevere neurological complications such as encephalitis, acuteflaccid paralysis, and pulmonary edema in children (1). EV71 belongs to the genus Enterovirus within the Picorna viridae family, which is a non-enveloped virus with a singlepositive-stranded RNA genome.EV71 3C protein is a 183 amino acid cysteine protease that can cleave most structural and non-structural proteins of EV71. Based on the analysis and understanding of EV71 3C protease, it is helpful to study and treat diseases caused by EV71 virus infection. The EV71 3C protease promotes virus replication by cleaving EV71 synthesis or host proteins. Moreover, EV71 3C protease inhibits the innate immune system and causes apoptosis.
Klonalität: Polyclonal
Reinheit: Affinity purification
Sequenz: MGSQVSTQRSGSHENSNSATEGSTINYTTINYYKDSYAATAGKQSLKQDPDKFANPVKDIFTEMAAPLKSPSAEACGYSDRVAQLTIGNSTITTQEAANIIVGYGEWPSYCSDSDATAVDKPTRPDVSVNRFYTLDTKLWEKSSKGWYWKFPDVLTETGVFGQNAQFHYLYRSGFCIHVQCNA
Target-Kategorie: EV71
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Other (Wide Range Predicted). Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using EV71 3C Rabbit pAb (A20687) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.