[KO Validated] SIRT3 Rabbit mAb, Unconjugated, Monoclonal

Artikelnummer: ABB-A20805
Artikelname: [KO Validated] SIRT3 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer: ABB-A20805
Hersteller Artikelnummer: A20805
Alternativnummer: ABB-A20805-100UL,ABB-A20805-20UL,ABB-A20805-1000UL,ABB-A20805-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SIR2L3, T3
SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC51526]
Molekulargewicht: 44kDa
NCBI: 23410
UniProt: Q9NTG7
Reinheit: Affinity purification
Sequenz: QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Target-Kategorie: SIRT3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|IHC-P,1:500 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and SIRT3 knockout (KO) 293T cells using [KO Validated] SIRT3 Rabbit mAb (A20805) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using [KO Validated] SIRT3 Rabbit mAb (A20805) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of various lysates, using [KO Validated] SIRT3 Rabbit mAb (A20805) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] SIRT3 Rabbit mAb (A20805) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using [KO Validated] SIRT3 Rabbit mAb (A20805) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using [KO Validated] SIRT3 Rabbit mAb (A20805) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunoprecipitation analysis of 300ug extracts of Hela cells using 3ug SIRT3 Rabbit mAb (A20805). Western blot was performed from the immunoprecipitate using SIRT3 Rabbit mAb (A20805) at a dilition of 1:1000.
Immunoprecipitation analysis of 300ug extracts of Hela cells using 3ug SIRT3 Rabbit mAb (A20805). Western blot was performed from the immunoprecipitate using SIRT3 Rabbit mAb (A20805) at a dilition of 1:1000.