[KD Validated] IRAK4 Rabbit mAb, Unconjugated, Monoclonal
Artikelnummer:
ABB-A20839
- Bilder (1)
| Artikelname: | [KD Validated] IRAK4 Rabbit mAb, Unconjugated, Monoclonal |
| Artikelnummer: | ABB-A20839 |
| Hersteller Artikelnummer: | A20839 |
| Alternativnummer: | ABB-A20839-100UL,ABB-A20839-20UL,ABB-A20839-500UL,ABB-A20839-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IPD1, IMD67, REN64, IRAK-4, NY-REN-64, [KD Validated] IRAK4 |
| This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC51289] |
| Molekulargewicht: | 52kDa |
| NCBI: | 51135 |
| UniProt: | Q9NWZ3 |
| Reinheit: | Affinity purification |
| Sequenz: | MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV |
| Target-Kategorie: | IRAK4 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,Immunology Inflammation,Cytokines,Interleukins,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling,Cardiovascular. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from wild type(WT) and IRAK4 knockdown (KD) 293T cells, using [KD Validated] IRAK4 Rabbit mAb (A20839) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
