POU2F2 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A21297
Artikelname: POU2F2 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A21297
Hersteller Artikelnummer: A21297
Alternativnummer: ABB-A21297-20UL,ABB-A21297-100UL,ABB-A21297-500UL,ABB-A21297-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: OCT2, OTF2, Oct-2, POU2F2
The protein encoded by this gene is a homeobox-containing transcription factor of the POU domain family. The encoded protein binds the octamer sequence 5-ATTTGCAT-3, a common transcription factor binding site in immunoglobulin gene promoters. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 51kDa
NCBI: 5452
UniProt: P09086
Reinheit: Affinity purification
Sequenz: VTTLSSAVGTLHPSRTAGGGGGGGGAAPPLNSIPSVTPPPPATTNSTNPSPQGSHSAIGLSGLNPSTGPGLWWNPAPYQP
Target-Kategorie: POU2F2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Immunology Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using POU2F2 Rabbit pAb (A21297) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.