MYL6B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21363
Artikelname: MYL6B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21363
Hersteller Artikelnummer: A21363
Alternativnummer: ABB-A21363-20UL,ABB-A21363-100UL,ABB-A21363-1000UL,ABB-A21363-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MLC1SA, MYL6B
Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 140465
UniProt: P14649
Reinheit: Affinity purification
Sequenz: MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
Target-Kategorie: MYL6B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cytoskeleton,Motor Proteins,Actins. Shipping: Ice Bag
Western blot analysis of various lysates using MYL6B Rabbit pAb (A21363) at 1:1000 dilution._Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25µg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.