FKBP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21404
Artikelname: FKBP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21404
Hersteller Artikelnummer: A21404
Alternativnummer: ABB-A21404-100UL,ABB-A21404-20UL,ABB-A21404-1000UL,ABB-A21404-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FKBP13, PPIase, FKBP-13, FKBP2
The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 2286
UniProt: P26885
Reinheit: Affinity purification
Sequenz: ATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Target-Kategorie: FKBP2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of various lysates using FKBP2 Rabbit pAb (A21404) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.