CD146/MCAM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21488
- Bilder (1)
| Artikelname: | CD146/MCAM Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21488 |
| Hersteller Artikelnummer: | A21488 |
| Alternativnummer: | ABB-A21488-20UL,ABB-A21488-100UL,ABB-A21488-500UL,ABB-A21488-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD146, MUC18, HEMCAM, METCAM, MelCAM, CD146/MCAM |
| Involved in glomerular filtration and vascular wound healing. Acts upstream of or within angiogenesis. Located in external side of plasma membrane. Biomarker of chronic obstructive pulmonary disease and uveal melanoma. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 72kDa |
| NCBI: | 4162 |
| UniProt: | P43121 |
| Reinheit: | Affinity purification |
| Sequenz: | VLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH |
| Target-Kategorie: | MCAM |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CD146/MCAM Rabbit pAb (A21488) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
