KBTBD3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2152
- Bilder (1)
| Artikelname: | KBTBD3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2152 |
| Hersteller Artikelnummer: | A2152 |
| Alternativnummer: | ABB-A2152-100UL,ABB-A2152-20UL,ABB-A2152-500UL,ABB-A2152-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Bklhd3, 2200003A07Rik, KBTBD3 |
| Is expressed in several structures, including central nervous system, dorsal root ganglion, early conceptus, genitourinary system, and tooth. Orthologous to human KBTBD3 (kelch repeat and BTB domain containing 3). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 69kDa |
| NCBI: | 69149 |
| Reinheit: | Affinity purification |
| Sequenz: | GSQDIKSLLDVESYNPLSREWTSVSPLPRGIYYPEASACQNIIYVLGSEVEIADAFNPSLDCFFKYNATTDQWSELVAEFGQFFHATLIKAVPVNCTLYICDLSTYKVYSFCPDTCVWKGEGSFECAGFNAGAIGIEDKIYILGGDYAPDEITDEVQVYHSSRSEWEEVSPMPRALTEFYCQVIQFNKYRDPWYSNHF |
| Target-Kategorie: | Kbtbd3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cell Biology & Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from PC-3 cells, using KBTBD3 Rabbit pAb (A2152). Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Produktgarantie und fachkundiger Support
