SPDYA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2153
- Bilder (1)
| Artikelname: | SPDYA Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2153 |
| Hersteller Artikelnummer: | A2153 |
| Alternativnummer: | ABB-A2153-20UL,ABB-A2153-100UL,ABB-A2153-500UL,ABB-A2153-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SPY1, SPDY1, RINGO3, RINGOA, SPDYA |
| Enables protein kinase activator activity and protein kinase binding activity. Involved in several processes, including G1/S transition of mitotic cell cycle, positive regulation of cell population proliferation, and positive regulation of protein kinase activity. Located in nucleoplasm. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 36kDa |
| NCBI: | 245711 |
| UniProt: | Q5MJ70 |
| Reinheit: | Affinity purification |
| Sequenz: | MRHNQMCCETPPTVTVYVKSGSNRSHQPKKPITLKRPICKDNWQAFEKNTHNNNKSKRPKGPCLVIQRQDMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTISEHTRINFFIALYLANTVEEDEEETKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAIAPTHYIWQRERSVHHSGAVRNYNRDEVQLPRGPSATPVDCSLCGKKRRYVRLGLSSSSSLSSHTAGV |
| Target-Kategorie: | SPDYA |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Kinase,Apoptosis,Cell Cycle. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SPDYA Rabbit pAb (A2153) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
