Glutamine Synthetase (GLUL) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21822
- Bilder (8)
| Artikelname: | Glutamine Synthetase (GLUL) Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21822 |
| Hersteller Artikelnummer: | A21822 |
| Alternativnummer: | ABB-A21822-20UL,ABB-A21822-100UL,ABB-A21822-500UL,ABB-A21822-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GS, GLNS, PIG43, PIG59, Glutamine Synthetase (GLUL) |
| The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 42kDa |
| NCBI: | 2752 |
| UniProt: | P15104 |
| Reinheit: | Affinity purification |
| Sequenz: | MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTN |
| Target-Kategorie: | GLUL |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Neuron marker. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embeddedMouse liver tissue usingGlutamine Synthetase (GLUL) Rabbit pAb(A21822) at a dilution of1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedHuman liver tissue usingGlutamine Synthetase (GLUL) Rabbit pAb(A21822) at a dilution of1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates, using Glutamine Synthetase (GLUL) Rabbit pAb (A21822) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
|
|
Immunohistochemistry analysis of paraffin-embeddedHuman tonsil tissue usingGlutamine Synthetase (GLUL) Rabbit pAb(A21822) at a dilution of1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedRat liver tissue usingGlutamine Synthetase (GLUL) Rabbit pAb(A21822) at a dilution of1:1000 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining. |
|
|
Immunofluorescence analysis of HeLa cells using Glutamine Synthetase (GLUL) Rabbit pAb (A21822) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of NIH/3T3 cells using Glutamine Synthetase (GLUL) Rabbit pAb (A21822) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
|
|
Immunofluorescence analysis of PC-12 cells using Glutamine Synthetase (GLUL) Rabbit pAb (A21822) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. |
Produktgarantie und fachkundiger Support
