HPRT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A21825
- Bilder (1)
| Artikelname: | HPRT1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A21825 |
| Hersteller Artikelnummer: | A21825 |
| Alternativnummer: | ABB-A21825-20UL,ABB-A21825-100UL,ABB-A21825-1000UL,ABB-A21825-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HPRT, HGPRT, HPRT1 |
| The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 25kDa |
| NCBI: | 3251 |
| UniProt: | P00492 |
| Reinheit: | Affinity purification |
| Sequenz: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA |
| Target-Kategorie: | HPRT1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using HPRT1 Rabbit pAb (A21825) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
