HPRT1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21825
Artikelname: HPRT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21825
Hersteller Artikelnummer: A21825
Alternativnummer: ABB-A21825-20UL,ABB-A21825-100UL,ABB-A21825-1000UL,ABB-A21825-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HPRT, HGPRT, HPRT1
The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 3251
UniProt: P00492
Reinheit: Affinity purification
Sequenz: MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
Target-Kategorie: HPRT1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using HPRT1 Rabbit pAb (A21825) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.