PMS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2183
- Bilder (1)
| Artikelname: | PMS1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2183 |
| Hersteller Artikelnummer: | A2183 |
| Alternativnummer: | ABB-A2183-100UL,ABB-A2183-20UL,ABB-A2183-500UL,ABB-A2183-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MLH2, PMSL1, hPMS1, HNPCC3, PMS1 |
| This gene encodes a protein belonging to the DNA mismatch repair mutL/hexB family. This protein is thought to be involved in the repair of DNA mismatches, and it can form heterodimers with MLH1, a known DNA mismatch repair protein. Mutations in this gene cause hereditary nonpolyposis colorectal cancer type 3 (HNPCC3) either alone or in combination with mutations in other genes involved in the HNPCC phenotype, which is also known as Lynch syndrome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 106kDa |
| NCBI: | 5378 |
| UniProt: | P54277 |
| Reinheit: | Affinity purification |
| Sequenz: | DCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEEKLK |
| Target-Kategorie: | PMS1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PMS1 Rabbit pAb (A2183) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
