AMOT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21843
Artikelname: AMOT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21843
Hersteller Artikelnummer: A21843
Alternativnummer: ABB-A21843-20UL,ABB-A21843-100UL,ABB-A21843-1000UL,ABB-A21843-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AMOT, angiomotin
This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 118kDa
NCBI: 154796
UniProt: Q4VCS5
Reinheit: Affinity purification
Sequenz: QTQAPTSAPAVAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHSNTLERKTPIQILGQEPDAEMVEYLI
Target-Kategorie: AMOT
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Cell Adhesion,Tight Junctions,Cytoskeleton,Microfilaments,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung usingAMOT Rabbit pAb (A21843) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 120s.