ZAP70 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2195
- Bilder (1)
| Artikelname: | ZAP70 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2195 |
| Hersteller Artikelnummer: | A2195 |
| Alternativnummer: | ABB-A2195-20UL,ABB-A2195-100UL,ABB-A2195-500UL,ABB-A2195-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SRK, STD, TZK, STCD, IMD48, ADMIO2, ZAP-70, ZAP70 |
| This gene encodes an enzyme belonging to the protein tyrosine kinase family, and it plays a role in T-cell development and lymphocyte activation. This enzyme, which is phosphorylated on tyrosine residues upon T-cell antigen receptor (TCR) stimulation, functions in the initial step of TCR-mediated signal transduction in combination with the Src family kinases, Lck and Fyn. This enzyme is also essential for thymocyte development. Mutations in this gene cause selective T-cell defect, a severe combined immunodeficiency disease characterized by a selective absence of CD8-positive T-cells. Two transcript variants that encode different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 70kDa |
| NCBI: | 7535 |
| UniProt: | P43403 |
| Reinheit: | Affinity purification |
| Sequenz: | MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACP |
| Target-Kategorie: | ZAP70 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Immunology Inflammation,T Cell Receptor Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ZAP70 Rabbit pAb (A2195) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
