TLK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21987
Artikelname: TLK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21987
Hersteller Artikelnummer: A21987
Alternativnummer: ABB-A21987-20UL,ABB-A21987-100UL,ABB-A21987-1000UL,ABB-A21987-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PKU-beta, TLK1
The protein encoded by this gene is a serine/threonine kinase that may be involved in the regulation of chromatin assembly. The encoded protein is only active when it is phosphorylated, and this phosphorylation is cell cycle-dependent, with the maximal activity of this protein coming during S phase. The catalytic activity of this protein is diminished by DNA damage and by blockage of DNA replication. Three transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 87kDa
NCBI: 9874
UniProt: Q9UKI8
Reinheit: Affinity purification
Sequenz: FEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLRANCDLR
Target-Kategorie: TLK1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Kinase,ATM Signaling Pathway,Cell Biology Developmental Biology,Apoptosis. Shipping: Ice Bag
Western blot analysis of various lysates using TLK1 Rabbit pAb (A21987) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.