Human Neurogranin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22030
Artikelname: Human Neurogranin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22030
Hersteller Artikelnummer: A22030
Alternativnummer: ABB-A22030-20UL,ABB-A22030-100UL,ABB-A22030-1000UL,ABB-A22030-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RC3, hng, Human Neurogranin
Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects.
Klonalität: Polyclonal
Molekulargewicht: 8kDa
NCBI: 4900
UniProt: Q92686
Reinheit: Affinity purification
Sequenz: DCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
Target-Kategorie: NRGN
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase,Endocrine Metabolism,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using Human Neurogranin Rabbit pAb (A22030) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.