INTS11 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22031
- Bilder (1)
| Artikelname: | INTS11 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22031 |
| Hersteller Artikelnummer: | A22031 |
| Alternativnummer: | ABB-A22031-100UL,ABB-A22031-20UL,ABB-A22031-500UL,ABB-A22031-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RC68, INT11, RC-68, CPSF3L, CPSF73L, INTS11 |
| The Integrator complex contains at least 12 subunits and associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A, MIM 180660) and mediates the 3-prime end processing of small nuclear RNAs U1 (RNU1, MIM 180680) and U2 (RNU2, MIM 180690). INTS11, or CPSF3L, is the catalytic subunit of the Integrator complex (Baillat et al., 2005 [PubMed 16239144]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 68kDa |
| NCBI: | 54973 |
| UniProt: | Q5TA45 |
| Reinheit: | Affinity purification |
| Sequenz: | GQSLQIFRKWAGNEKNMVIMPGYCVQGTVGHKILSGQRKLEMEGRQVLEVKMQVEYMSFSAHADAKGIMQLVGQAEPESVLLVHGEAKKMEFLKQKIEQELRVNCYMPANGETVTLPTSPSIPVGISLGLLKREMAQGLLPEAKKPRLLHGTLIMKDSNFRLVSSEQALKELGLAEHQLRFTCRVHLHDTRKEQETALRVYSHLKSVLKDHCVQHLPDGSVTVESVLLQAAAPSEDPGTKVLLVSWTYQDEELGS |
| Target-Kategorie: | INTS11 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from 293F cells, using INTS11 Rabbit pAb (A22031) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
