CD123 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22111
- Bilder (1)
| Artikelname: | CD123 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22111 |
| Hersteller Artikelnummer: | A22111 |
| Alternativnummer: | ABB-A22111-100UL,ABB-A22111-20UL,ABB-A22111-500UL,ABB-A22111-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra, IL-3R-alpha |
| The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 43kDa |
| NCBI: | 3563 |
| UniProt: | P26951 |
| Reinheit: | Affinity purification |
| Sequenz: | KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRA |
| Target-Kategorie: | IL3RA |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Immunology Inflammation,CDs,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse spleen, using CD123 Rabbit pAb (A22111) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
