RBM20 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22117
- Bilder (1)
| Artikelname: | RBM20 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22117 |
| Hersteller Artikelnummer: | A22117 |
| Alternativnummer: | ABB-A22117-20UL,ABB-A22117-100UL,ABB-A22117-1000UL,ABB-A22117-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| This gene encodes a protein that binds RNA and regulates splicing. Mutations in this gene have been associated with familial dilated cardiomyopathy. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 134kDa |
| NCBI: | 282996 |
| UniProt: | Q5T481 |
| Reinheit: | Affinity purification |
| Sequenz: | AKQNEKNKTKRTDRDQEGADDRKENTMAENEAGKEEQEGMEESPQSVGRQEKEAEFSDPENTRTKKEQDWESESEAEGESWYPTNMEELVTVDEVGEEEDFIVEPDIPELEEIVPIDQKDKICPETCLCVTTTLDLDLAQDFPKEGVKAVGNGAAEISLKS |
| Target-Kategorie: | RBM20 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using RBM20 Rabbit pAb (A22117) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
