TMEM119 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22118
Artikelname: TMEM119 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22118
Hersteller Artikelnummer: A22118
Alternativnummer: ABB-A22118-20UL,ABB-A22118-100UL,ABB-A22118-500UL,ABB-A22118-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: OBIF, TMEM119
Involved in positive regulation of bone mineralization, positive regulation of osteoblast differentiation, and positive regulation of osteoblast proliferation. Located in plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 338773
UniProt: Q4V9L6
Reinheit: Affinity purification
Sequenz: SRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPP
Target-Kategorie: TMEM119
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates, using TMEM119 Rabbit pAb (A22118) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.