UPK3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A22120
- Bilder (1)
| Artikelname: | UPK3B Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A22120 |
| Hersteller Artikelnummer: | A22120 |
| Alternativnummer: | ABB-A22120-100UL,ABB-A22120-20UL,ABB-A22120-1000UL,ABB-A22120-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P35, UP3B, UPIIIB, UPK3B |
| UPK3B is a minor component of the apical plaques of mammalian urothelium that binds and dimerizes with uroplakin-1b (UPK1B, MIM 602380), one of the major conserved urothelium membrane proteins. The other major conserved integral membrane proteins of urothelial plaques are UPK1A (MIM 611557), UPK2 (MIM 611558), and UPK3A (MIM 611559) (Deng et al., 2002 [PubMed 12446744]). |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 34kDa |
| NCBI: | 105375355 |
| UniProt: | Q9BT76 |
| Reinheit: | Affinity purification |
| Sequenz: | RLGEAAPGTPTPVSVAHLLSPVATELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVAFSNASRGFQNPETLADIPASPQLLTDGHYMTLPLSPDQLPCGDPMAGSGGAPVLRVGHDHGCHQQPFCNA |
| Target-Kategorie: | UPK3B |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from 293F cells, using UPK3B Rabbit pAb (A22120) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
